PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr035399.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 542aa    MW: 60981.4 Da    PI: 8.3902
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr035399.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS331.71.3e-1011775402374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                   ++L+++Ae v +g+++ aq +Larl+++ sp g+p+qR+a+yf+eAL+  l+ + + +  + pp++ ++ + + ++ a+k+fsevsP+l+f ++t+N
  Pbr035399.1 177 LDQLYKAAELVGTGNFSHAQGILARLNHQLSPVGKPLQRAAFYFKEALQLLLLMNNPAT--SPPPRTPTPFDIIFKMGAYKVFSEVSPLLQFVNFTCN 272
                  679**************************************************955554..57888899999************************** PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl..elee 193
                  qa+lea++  +++Hi+Dfdi+ G++W++++q+L  R+  +++pslRiT++ sp++++  el+ ++++L++fA+e+g++f+ +v+  ++l++   +l  
  Pbr035399.1 273 QALLEALSDTDQIHIVDFDIGFGAHWASFMQELPIRNrgASAPSLRITAFTSPSTHHPVELRLMRDNLTQFANEIGISFDLEVVNIDSLDQNsySLPI 370
                  **********************************99966779*****************************************988877766224556 PP

         GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291
                  +r +++Ea+aVn+ +   ++ +++++l++    vL++vk+lsPk+vv  ++ +d+++ +F +++l+al+ y  l++sl+a    +s++ +k+Er+ll+
  Pbr035399.1 371 FRANNNEAVAVNFPI--WSTSNQPAALPN----VLRFVKQLSPKIVVSLDRGCDRSDLPFPQHILQALQSYINLLESLDAV-NVTSDAVNKIERFLLQ 461
                  78888********99..666678999999....*********************************************665.579************* PP

         GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ++i++ v  + +       ++  W+  + +aGF+pvp+s+++++qa++++++ + +g++ve++++slvl+W++r+L+s+SaWr
  Pbr035399.1 462 PKIESTVLGRLRT----PDKMPLWKTLFASAGFTPVPFSNFTETQAECVVKRNPARGFHVEKRQESLVLCWQRRELISASAWR 540
                  *******998887....9999*************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.214150520IPR005202Transcription factor GRAS
PfamPF035144.7E-99177540IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MHNNGGSNSV NCNIQNPIFS NSSNTLALPV SLPAVYGQQQ LSPDEKPQIL NPQLFMSNQN  60
QQPQVAQNPN FFMPLAYAQQ EQHHLLQSQP KRHNSGTNID PSTHQIQKGQ FSDPGQEFFM  120
RKQQQQQFGF AQGMQFLPQQ HRIQQKPLMV PKQKVVLGNG EEMAHHQQQQ QLQHTLLDQL  180
YKAAELVGTG NFSHAQGILA RLNHQLSPVG KPLQRAAFYF KEALQLLLLM NNPATSPPPR  240
TPTPFDIIFK MGAYKVFSEV SPLLQFVNFT CNQALLEALS DTDQIHIVDF DIGFGAHWAS  300
FMQELPIRNR GASAPSLRIT AFTSPSTHHP VELRLMRDNL TQFANEIGIS FDLEVVNIDS  360
LDQNSYSLPI FRANNNEAVA VNFPIWSTSN QPAALPNVLR FVKQLSPKIV VSLDRGCDRS  420
DLPFPQHILQ ALQSYINLLE SLDAVNVTSD AVNKIERFLL QPKIESTVLG RLRTPDKMPL  480
WKTLFASAGF TPVPFSNFTE TQAECVVKRN PARGFHVEKR QESLVLCWQR RELISASAWR  540
C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3219554022375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009343059.10.0PREDICTED: scarecrow-like protein 22
SwissprotO813161e-124SCL6_ARATH; Scarecrow-like protein 6
TrEMBLM5WE330.0M5WE33_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s11020.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132692130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-122GRAS family protein